Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4749335..4749973 | Replicon | chromosome |
Accession | NZ_CP103864 | ||
Organism | Escherichia coli O157:H7 strain RV06 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NUE47_RS23395 | Protein ID | WP_000813794.1 |
Coordinates | 4749797..4749973 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NUE47_RS23390 | Protein ID | WP_001270286.1 |
Coordinates | 4749335..4749751 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE47_RS23370 (4744487) | 4744487..4745428 | - | 942 | WP_001251320.1 | ABC transporter permease | - |
NUE47_RS23375 (4745429) | 4745429..4746442 | - | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
NUE47_RS23380 (4746460) | 4746460..4747605 | - | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
NUE47_RS23385 (4747850) | 4747850..4749256 | - | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
NUE47_RS23390 (4749335) | 4749335..4749751 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NUE47_RS23395 (4749797) | 4749797..4749973 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NUE47_RS23400 (4750195) | 4750195..4750425 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NUE47_RS23405 (4750517) | 4750517..4752478 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NUE47_RS23410 (4752551) | 4752551..4753087 | - | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
NUE47_RS23415 (4753179) | 4753179..4754351 | + | 1173 | WP_001236316.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T256863 WP_000813794.1 NZ_CP103864:c4749973-4749797 [Escherichia coli O157:H7]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT256863 WP_001270286.1 NZ_CP103864:c4749751-4749335 [Escherichia coli O157:H7]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|