Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3978173..3978651 Replicon chromosome
Accession NZ_CP103864
Organism Escherichia coli O157:H7 strain RV06

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag NUE47_RS19075 Protein ID WP_001303876.1
Coordinates 3978173..3978460 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag NUE47_RS19080 Protein ID WP_000536233.1
Coordinates 3978460..3978651 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUE47_RS19040 (3973322) 3973322..3975793 - 2472 WP_000034474.1 exonuclease -
NUE47_RS19045 (3975887) 3975887..3976078 - 192 WP_001098307.1 DUF1482 family protein -
NUE47_RS19050 (3976075) 3976075..3976263 - 189 WP_000413705.1 cell division inhibition protein DicB -
NUE47_RS19055 (3976837) 3976837..3977022 + 186 WP_001133046.1 hypothetical protein -
NUE47_RS19060 (3977209) 3977209..3977598 - 390 WP_000394511.1 hypothetical protein -
NUE47_RS19065 (3977610) 3977610..3977738 - 129 WP_000344963.1 protein YdfB -
NUE47_RS19070 (3977740) 3977740..3977895 - 156 WP_000379575.1 DUF1391 family protein -
NUE47_RS19075 (3978173) 3978173..3978460 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NUE47_RS19080 (3978460) 3978460..3978651 - 192 WP_000536233.1 hypothetical protein Antitoxin
NUE47_RS19085 (3978679) 3978679..3979080 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
NUE47_RS19090 (3979189) 3979189..3979461 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
NUE47_RS19095 (3979445) 3979445..3979870 + 426 WP_000693855.1 toxin YdaT family protein -
NUE47_RS19100 (3980077) 3980077..3980532 - 456 WP_000273724.1 hypothetical protein -
NUE47_RS19105 (3980611) 3980611..3981702 + 1092 WP_001205823.1 hypothetical protein -
NUE47_RS19110 (3981709) 3981709..3982455 + 747 WP_000788751.1 ATP-binding protein -
NUE47_RS19115 (3982477) 3982477..3983247 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T256861 WP_001303876.1 NZ_CP103864:c3978460-3978173 [Escherichia coli O157:H7]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT256861 WP_000536233.1 NZ_CP103864:c3978651-3978460 [Escherichia coli O157:H7]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References