Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3811785..3812490 | Replicon | chromosome |
Accession | NZ_CP103864 | ||
Organism | Escherichia coli O157:H7 strain RV06 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | NUE47_RS18320 | Protein ID | WP_000539519.1 |
Coordinates | 3812104..3812490 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NUE47_RS18315 | Protein ID | WP_001280945.1 |
Coordinates | 3811785..3812114 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE47_RS18300 (3806942) | 3806942..3807853 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
NUE47_RS18305 (3808031) | 3808031..3810379 | + | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
NUE47_RS18310 (3810387) | 3810387..3811715 | + | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
NUE47_RS18315 (3811785) | 3811785..3812114 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NUE47_RS18320 (3812104) | 3812104..3812490 | - | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUE47_RS18325 (3812716) | 3812716..3814041 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NUE47_RS18330 (3814254) | 3814254..3814637 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NUE47_RS18335 (3814748) | 3814748..3815863 | + | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
NUE47_RS18340 (3815860) | 3815860..3816486 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T256860 WP_000539519.1 NZ_CP103864:c3812490-3812104 [Escherichia coli O157:H7]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|