Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1629278..1630078 | Replicon | chromosome |
Accession | NZ_CP103864 | ||
Organism | Escherichia coli O157:H7 strain RV06 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A891SNC1 |
Locus tag | NUE47_RS08095 | Protein ID | WP_000342448.1 |
Coordinates | 1629278..1629805 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | NUE47_RS08100 | Protein ID | WP_001277108.1 |
Coordinates | 1629812..1630078 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE47_RS08070 (1624353) | 1624353..1625120 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NUE47_RS08075 (1625117) | 1625117..1626394 | - | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
NUE47_RS08080 (1626391) | 1626391..1627317 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NUE47_RS08085 (1627365) | 1627365..1628474 | - | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NUE47_RS08090 (1628898) | 1628898..1629281 | + | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NUE47_RS08095 (1629278) | 1629278..1629805 | - | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NUE47_RS08100 (1629812) | 1629812..1630078 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NUE47_RS08105 (1630228) | 1630228..1631331 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NUE47_RS08110 (1631602) | 1631602..1632456 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NUE47_RS08115 (1632701) | 1632701..1633759 | - | 1059 | WP_001042018.1 | permease-like cell division protein FtsX | - |
NUE47_RS08120 (1633752) | 1633752..1634420 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T256851 WP_000342448.1 NZ_CP103864:c1629805-1629278 [Escherichia coli O157:H7]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|