Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1580394..1581148 | Replicon | chromosome |
Accession | NZ_CP103864 | ||
Organism | Escherichia coli O157:H7 strain RV06 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | NUE47_RS07885 | Protein ID | WP_001301452.1 |
Coordinates | 1580663..1581148 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | NUE47_RS07880 | Protein ID | WP_000801912.1 |
Coordinates | 1580394..1580672 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE47_RS07875 (1577622) | 1577622..1580327 | + | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
NUE47_RS07880 (1580394) | 1580394..1580672 | + | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
NUE47_RS07885 (1580663) | 1580663..1581148 | + | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
NUE47_RS07890 (1581198) | 1581198..1582226 | - | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
NUE47_RS07895 (1582230) | 1582230..1583456 | - | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
NUE47_RS07900 (1583644) | 1583644..1585242 | + | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
NUE47_RS07905 (1585224) | 1585224..1585982 | - | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T256850 WP_001301452.1 NZ_CP103864:1580663-1581148 [Escherichia coli O157:H7]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|