Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1091170..1091824 | Replicon | chromosome |
| Accession | NZ_CP103864 | ||
| Organism | Escherichia coli O157:H7 strain RV06 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NUE47_RS05360 | Protein ID | WP_000244781.1 |
| Coordinates | 1091170..1091577 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NUE47_RS05365 | Protein ID | WP_000354046.1 |
| Coordinates | 1091558..1091824 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE47_RS05340 (1087127) | 1087127..1088860 | - | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NUE47_RS05345 (1088866) | 1088866..1089576 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NUE47_RS05350 (1089601) | 1089601..1090497 | - | 897 | WP_000806640.1 | site-specific tyrosine recombinase XerD | - |
| NUE47_RS05355 (1090609) | 1090609..1091130 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NUE47_RS05360 (1091170) | 1091170..1091577 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NUE47_RS05365 (1091558) | 1091558..1091824 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NUE47_RS05370 (1092067) | 1092067..1093047 | + | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
| NUE47_RS05375 (1093124) | 1093124..1093783 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NUE47_RS05380 (1093947) | 1093947..1094258 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| NUE47_RS05385 (1094303) | 1094303..1095559 | + | 1257 | WP_009671380.1 | family 1 glycosylhydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T256847 WP_000244781.1 NZ_CP103864:c1091577-1091170 [Escherichia coli O157:H7]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|