Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 32419..33556 | Replicon | plasmid unnamed1 |
Accession | NZ_CP103862 | ||
Organism | Enterococcus faecalis strain SJ82 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NYR15_RS00210 | Protein ID | WP_002333003.1 |
Coordinates | 32419..33282 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | B3CKC7 |
Locus tag | NYR15_RS00215 | Protein ID | WP_002333002.1 |
Coordinates | 33284..33556 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR15_RS00185 (27634) | 27634..28218 | + | 585 | WP_258077898.1 | IS30 family transposase | - |
NYR15_RS00190 (28290) | 28290..29903 | - | 1614 | WP_002333004.1 | hypothetical protein | - |
NYR15_RS00195 (29927) | 29927..30808 | - | 882 | WP_002326774.1 | ABC transporter ATP-binding protein | - |
NYR15_RS00200 (31119) | 31119..31715 | + | 597 | WP_002326773.1 | TetR/AcrR family transcriptional regulator | - |
NYR15_RS00205 (31884) | 31884..32288 | - | 405 | Protein_40 | DnaJ domain-containing protein | - |
NYR15_RS00210 (32419) | 32419..33282 | - | 864 | WP_002333003.1 | zeta toxin family protein | Toxin |
NYR15_RS00215 (33284) | 33284..33556 | - | 273 | WP_002333002.1 | antitoxin | Antitoxin |
NYR15_RS00220 (33574) | 33574..33789 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
NYR15_RS00225 (33881) | 33881..34777 | - | 897 | WP_104681373.1 | ParA family protein | - |
NYR15_RS00230 (34880) | 34880..36715 | - | 1836 | WP_232035937.1 | type IA DNA topoisomerase | - |
NYR15_RS00235 (36933) | 36933..37163 | + | 231 | WP_181039775.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3')-III / erm(B) / dfrG | - | 1..40153 | 40153 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32365.76 Da Isoelectric Point: 6.3643
>T256827 WP_002333003.1 NZ_CP103862:c33282-32419 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|