Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 17797..18368 Replicon plasmid unnamed1
Accession NZ_CP103862
Organism Enterococcus faecalis strain SJ82

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag NYR15_RS00140 Protein ID WP_002362432.1
Coordinates 18027..18368 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag NYR15_RS00135 Protein ID WP_002362431.1
Coordinates 17797..18027 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR15_RS00090 (13244) 13244..13585 + 342 WP_002382053.1 hypothetical protein -
NYR15_RS00095 (13744) 13744..14040 - 297 WP_002403282.1 hypothetical protein -
- (14149) 14149..14240 + 92 NuclAT_0 - -
- (14149) 14149..14240 + 92 NuclAT_0 - -
- (14149) 14149..14240 + 92 NuclAT_0 - -
- (14149) 14149..14240 + 92 NuclAT_0 - -
NYR15_RS00100 (14280) 14280..14369 - 90 WP_153829630.1 type I toxin-antitoxin system Fst family toxin -
NYR15_RS00105 (14885) 14885..15202 + 318 WP_002394802.1 heavy metal-binding domain-containing protein -
NYR15_RS00110 (15238) 15238..15906 + 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
NYR15_RS00115 (16023) 16023..16277 + 255 WP_002394800.1 hypothetical protein -
NYR15_RS00120 (16437) 16437..16670 - 234 WP_002394799.1 hypothetical protein -
NYR15_RS00125 (16672) 16672..16956 - 285 WP_002394798.1 hypothetical protein -
NYR15_RS00130 (16973) 16973..17593 - 621 WP_013438829.1 recombinase family protein -
NYR15_RS00135 (17797) 17797..18027 + 231 WP_002362431.1 hypothetical protein Antitoxin
NYR15_RS00140 (18027) 18027..18368 + 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NYR15_RS00145 (18480) 18480..19418 + 939 WP_002362433.1 hypothetical protein -
NYR15_RS00150 (19683) 19683..20285 + 603 WP_002362434.1 Fic family protein -
NYR15_RS00155 (20424) 20424..21580 + 1157 WP_100815066.1 IS3 family transposase -
NYR15_RS00160 (21686) 21686..22969 + 1284 WP_002362438.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-III / erm(B) / dfrG - 1..40153 40153


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T256826 WP_002362432.1 NZ_CP103862:18027-18368 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT256826 WP_002362431.1 NZ_CP103862:17797-18027 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References