Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2203516..2203993 Replicon chromosome
Accession NZ_CP103860
Organism Staphylococcus aureus strain R3-8

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag NYR13_RS11295 Protein ID WP_000052078.1
Coordinates 2203805..2203993 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NYR13_RS11290 Protein ID WP_001059690.1
Coordinates 2203516..2203776 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR13_RS11255 (2198909) 2198909..2199625 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
NYR13_RS11260 (2199773) 2199773..2200195 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
NYR13_RS11265 (2200594) 2200594..2201088 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NYR13_RS11270 (2201243) 2201243..2201860 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NYR13_RS11275 (2201933) 2201933..2202514 - 582 WP_001140686.1 histidine phosphatase family protein -
NYR13_RS11280 (2202739) 2202739..2202975 + 237 WP_000368687.1 hypothetical protein -
NYR13_RS11285 (2202972) 2202972..2203175 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NYR13_RS11290 (2203516) 2203516..2203776 + 261 WP_001059690.1 hypothetical protein Antitoxin
NYR13_RS11295 (2203805) 2203805..2203993 + 189 WP_000052078.1 hypothetical protein Toxin
NYR13_RS11300 (2204181) 2204181..2204750 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NYR13_RS11305 (2204838) 2204838..2205122 + 285 WP_001004395.1 hypothetical protein -
NYR13_RS11310 (2205184) 2205184..2205402 + 219 WP_000005886.1 hypothetical protein -
NYR13_RS11315 (2205898) 2205898..2206098 - 201 WP_001059082.1 cold-shock protein -
NYR13_RS11320 (2206455) 2206455..2207141 - 687 WP_001548082.1 thermonuclease family protein -
NYR13_RS11325 (2207482) 2207482..2207952 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 2178227..2221845 43618


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T256825 WP_000052078.1 NZ_CP103860:2203805-2203993 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT256825 WP_001059690.1 NZ_CP103860:2203516-2203776 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References