Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1054809..1055585 | Replicon | chromosome |
| Accession | NZ_CP103860 | ||
| Organism | Staphylococcus aureus strain R3-8 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NYR13_RS05495 | Protein ID | WP_000031108.1 |
| Coordinates | 1055433..1055585 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NYR13_RS05490 | Protein ID | WP_001251224.1 |
| Coordinates | 1054809..1055408 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR13_RS05470 (1050725) | 1050725..1052182 | + | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
| NYR13_RS05475 (1052175) | 1052175..1052897 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NYR13_RS05480 (1053048) | 1053048..1054175 | + | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NYR13_RS05485 (1054180) | 1054180..1054650 | + | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NYR13_RS05490 (1054809) | 1054809..1055408 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NYR13_RS05495 (1055433) | 1055433..1055585 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NYR13_RS05500 (1056362) | 1056362..1056757 | + | 396 | WP_000901021.1 | hypothetical protein | - |
| NYR13_RS05505 (1056953) | 1056953..1058338 | + | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
| NYR13_RS05510 (1058801) | 1058801..1059622 | - | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T256823 WP_000031108.1 NZ_CP103860:1055433-1055585 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT256823 WP_001251224.1 NZ_CP103860:1054809-1055408 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|