Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 854300..854829 | Replicon | chromosome |
| Accession | NZ_CP103860 | ||
| Organism | Staphylococcus aureus strain R3-8 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NYR13_RS04230 | Protein ID | WP_000621175.1 |
| Coordinates | 854467..854829 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NYR13_RS04225 | Protein ID | WP_000948331.1 |
| Coordinates | 854300..854470 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR13_RS04195 (849337) | 849337..849897 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| NYR13_RS04200 (850105) | 850105..850584 | + | 480 | WP_001287088.1 | hypothetical protein | - |
| NYR13_RS04205 (850577) | 850577..852160 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| NYR13_RS04210 (852147) | 852147..852638 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
| NYR13_RS04215 (852642) | 852642..853001 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NYR13_RS04220 (853067) | 853067..854215 | + | 1149 | WP_001281145.1 | alanine racemase | - |
| NYR13_RS04225 (854300) | 854300..854470 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NYR13_RS04230 (854467) | 854467..854829 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NYR13_RS04235 (855179) | 855179..856180 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NYR13_RS04240 (856299) | 856299..856625 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NYR13_RS04245 (856627) | 856627..857106 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NYR13_RS04250 (857081) | 857081..857851 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T256819 WP_000621175.1 NZ_CP103860:854467-854829 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|