Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1271636..1272553 | Replicon | chromosome |
Accession | NZ_CP103856 | ||
Organism | Bacillus velezensis strain SRCM116265 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NX081_RS06665 | Protein ID | WP_032866111.1 |
Coordinates | 1271807..1272553 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | NX081_RS06660 | Protein ID | WP_060561801.1 |
Coordinates | 1271636..1271806 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX081_RS06620 (1266861) | 1266861..1268492 | + | 1632 | WP_060561803.1 | pyocin knob domain-containing protein | - |
NX081_RS06625 (1268505) | 1268505..1268876 | + | 372 | WP_060561802.1 | XkdW family protein | - |
NX081_RS06630 (1268881) | 1268881..1269078 | + | 198 | WP_059367156.1 | XkdX family protein | - |
NX081_RS06635 (1269135) | 1269135..1269895 | + | 761 | Protein_1246 | phage portal protein | - |
NX081_RS06640 (1269947) | 1269947..1270210 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NX081_RS06645 (1270224) | 1270224..1270487 | + | 264 | WP_003154813.1 | phage holin | - |
NX081_RS06650 (1270501) | 1270501..1271379 | + | 879 | WP_043021264.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX081_RS06655 (1271414) | 1271414..1271539 | - | 126 | WP_023356844.1 | hypothetical protein | - |
NX081_RS06660 (1271636) | 1271636..1271806 | - | 171 | WP_060561801.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NX081_RS06665 (1271807) | 1271807..1272553 | - | 747 | WP_032866111.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NX081_RS06670 (1272658) | 1272658..1273656 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
NX081_RS06675 (1273669) | 1273669..1274286 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NX081_RS06680 (1274572) | 1274572..1275888 | - | 1317 | WP_007610842.1 | amino acid permease | - |
NX081_RS06685 (1276211) | 1276211..1277161 | + | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1237844..1330083 | 92239 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29095.60 Da Isoelectric Point: 4.7755
>T256807 WP_032866111.1 NZ_CP103856:c1272553-1271807 [Bacillus velezensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|