Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 487425..488062 | Replicon | chromosome |
Accession | NZ_CP103856 | ||
Organism | Bacillus velezensis strain SRCM116265 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NX081_RS02470 | Protein ID | WP_003156187.1 |
Coordinates | 487712..488062 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NX081_RS02465 | Protein ID | WP_003156188.1 |
Coordinates | 487425..487706 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX081_RS02445 (483790) | 483790..484389 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NX081_RS02450 (484482) | 484482..484847 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
NX081_RS02455 (485012) | 485012..486019 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
NX081_RS02460 (486136) | 486136..487305 | + | 1170 | WP_025284272.1 | alanine racemase | - |
NX081_RS02465 (487425) | 487425..487706 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NX081_RS02470 (487712) | 487712..488062 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NX081_RS02475 (488180) | 488180..489001 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NX081_RS02480 (489006) | 489006..489371 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NX081_RS02485 (489374) | 489374..489775 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NX081_RS02490 (489787) | 489787..490794 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
NX081_RS02495 (490858) | 490858..491187 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NX081_RS02500 (491184) | 491184..491666 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NX081_RS02505 (491632) | 491632..492420 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NX081_RS02510 (492420) | 492420..493022 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T256806 WP_003156187.1 NZ_CP103856:487712-488062 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|