Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 1293025..1293686 | Replicon | chromosome |
Accession | NZ_CP103852 | ||
Organism | Ralstonia pseudosolanacearum strain LMG 9673 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NY025_RS13890 | Protein ID | WP_193026209.1 |
Coordinates | 1293025..1293438 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | D8N5P4 |
Locus tag | NY025_RS13895 | Protein ID | WP_020749302.1 |
Coordinates | 1293435..1293686 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY025_RS13865 (NY025_13865) | 1288431..1288721 | - | 291 | WP_197366495.1 | H-NS family nucleoid-associated regulatory protein | - |
NY025_RS13870 (NY025_13870) | 1288903..1289898 | - | 996 | WP_280926349.1 | YopJ family acetyltransferase | - |
NY025_RS13875 (NY025_13875) | 1290623..1290847 | + | 225 | WP_230643474.1 | DUF6441 family protein | - |
NY025_RS13880 (NY025_13880) | 1290890..1291180 | - | 291 | WP_193026211.1 | H-NS family nucleoid-associated regulatory protein | - |
NY025_RS13885 (NY025_13885) | 1291732..1292880 | + | 1149 | WP_197366493.1 | DNA cytosine methyltransferase | - |
NY025_RS13890 (NY025_13890) | 1293025..1293438 | - | 414 | WP_193026209.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NY025_RS13895 (NY025_13895) | 1293435..1293686 | - | 252 | WP_020749302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NY025_RS13900 (NY025_13900) | 1293762..1297862 | + | 4101 | WP_259423536.1 | tape measure protein | - |
NY025_RS13905 (NY025_13905) | 1297868..1298263 | + | 396 | WP_197366423.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1267290..1307420 | 40130 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15742.09 Da Isoelectric Point: 6.2337
>T256804 WP_193026209.1 NZ_CP103852:c1293438-1293025 [Ralstonia pseudosolanacearum]
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|