Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 1200682..1201226 | Replicon | chromosome |
| Accession | NZ_CP103852 | ||
| Organism | Ralstonia pseudosolanacearum strain LMG 9673 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NY025_RS13440 | Protein ID | WP_193027890.1 |
| Coordinates | 1200682..1200957 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NY025_RS13445 | Protein ID | WP_193027891.1 |
| Coordinates | 1200957..1201226 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NY025_RS13410 (NY025_13410) | 1196085..1196501 | + | 417 | WP_193027885.1 | hypothetical protein | - |
| NY025_RS13415 (NY025_13415) | 1196572..1197921 | + | 1350 | WP_193027886.1 | replication-associated recombination protein A | - |
| NY025_RS13420 (NY025_13420) | 1197988..1199304 | + | 1317 | WP_193027887.1 | serine--tRNA ligase | - |
| NY025_RS13430 (NY025_13430) | 1199528..1200091 | + | 564 | WP_193027888.1 | recombinase family protein | - |
| NY025_RS13435 (NY025_13435) | 1200069..1200629 | - | 561 | WP_193027889.1 | DUF2726 domain-containing protein | - |
| NY025_RS13440 (NY025_13440) | 1200682..1200957 | - | 276 | WP_193027890.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NY025_RS13445 (NY025_13445) | 1200957..1201226 | - | 270 | WP_193027891.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NY025_RS13450 (NY025_13450) | 1201392..1201979 | - | 588 | WP_230642671.1 | NAD(P)H-dependent oxidoreductase | - |
| NY025_RS13455 (NY025_13455) | 1202170..1202580 | - | 411 | WP_230642669.1 | alpha/beta hydrolase | - |
| NY025_RS13460 (NY025_13460) | 1202633..1203649 | + | 1017 | WP_193027114.1 | IS21 family transposase | - |
| NY025_RS13465 (NY025_13465) | 1203646..1204434 | + | 789 | WP_193027111.1 | IS21-like element ISRso19 family helper ATPase IstB | - |
| NY025_RS13470 (NY025_13470) | 1204510..1204911 | - | 402 | Protein_1116 | alpha/beta hydrolase | - |
| NY025_RS13475 (NY025_13475) | 1205043..1205942 | + | 900 | WP_193035960.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1196085..1205942 | 9857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10630.33 Da Isoelectric Point: 10.1779
>T256803 WP_193027890.1 NZ_CP103852:c1200957-1200682 [Ralstonia pseudosolanacearum]
MEVKWTGKAVSDITRLYEFLSQVNKPAAIRVVQSLTGAPKSLVVNPRIGEQLDEFEPREVRRIIVGQYEMRYAIRGSVIY
VLRLWHTREDR
MEVKWTGKAVSDITRLYEFLSQVNKPAAIRVVQSLTGAPKSLVVNPRIGEQLDEFEPREVRRIIVGQYEMRYAIRGSVIY
VLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|