Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 444712..445345 | Replicon | chromosome |
Accession | NZ_CP103852 | ||
Organism | Ralstonia pseudosolanacearum strain LMG 9673 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NY025_RS09850 | Protein ID | WP_193027353.1 |
Coordinates | 444932..445345 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | D8N529 |
Locus tag | NY025_RS09845 | Protein ID | WP_020747258.1 |
Coordinates | 444712..444945 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NY025_RS09830 (NY025_09830) | 440291..441586 | - | 1296 | WP_193027348.1 | MFS transporter | - |
NY025_RS09835 (NY025_09835) | 441594..442826 | - | 1233 | WP_193027350.1 | AGE family epimerase/isomerase | - |
NY025_RS09840 (NY025_09840) | 443048..444655 | + | 1608 | WP_193028416.1 | glucan biosynthesis protein | - |
NY025_RS09845 (NY025_09845) | 444712..444945 | + | 234 | WP_020747258.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NY025_RS09850 (NY025_09850) | 444932..445345 | + | 414 | WP_193027353.1 | PIN domain-containing protein | Toxin |
NY025_RS09855 (NY025_09855) | 445320..445949 | - | 630 | WP_193027355.1 | DUF1415 family protein | - |
NY025_RS09860 (NY025_09860) | 445993..447489 | - | 1497 | WP_193027357.1 | glycerol kinase GlpK | - |
NY025_RS09865 (NY025_09865) | 447657..447884 | - | 228 | Protein_414 | carbohydrate ABC transporter substrate-binding protein | - |
NY025_RS09870 (NY025_09870) | 447885..448007 | - | 123 | Protein_415 | ABC transporter | - |
NY025_RS09875 (NY025_09875) | 448264..449841 | - | 1578 | WP_193027360.1 | glycerol-3-phosphate dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15091.41 Da Isoelectric Point: 5.5407
>T256802 WP_193027353.1 NZ_CP103852:444932-445345 [Ralstonia pseudosolanacearum]
MPATEAFFDSNVVLYLLSADAAKADTAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRIEPLTLET
HELGRRLAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVVEQHLRIVNPFSARA
MPATEAFFDSNVVLYLLSADAAKADTAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRIEPLTLET
HELGRRLAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVVEQHLRIVNPFSARA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|