Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 270378..271039 | Replicon | chromosome |
| Accession | NZ_CP103852 | ||
| Organism | Ralstonia pseudosolanacearum strain LMG 9673 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NY025_RS09080 | Protein ID | WP_259423471.1 |
| Coordinates | 270378..270791 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D8N5P4 |
| Locus tag | NY025_RS09085 | Protein ID | WP_020749302.1 |
| Coordinates | 270788..271039 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NY025_RS09045 (NY025_09045) | 265890..266660 | + | 771 | WP_259423464.1 | hypothetical protein | - |
| NY025_RS09050 (NY025_09050) | 266669..267061 | + | 393 | WP_197366558.1 | hypothetical protein | - |
| NY025_RS09055 (NY025_09055) | 267112..267279 | + | 168 | WP_230643730.1 | hypothetical protein | - |
| NY025_RS09060 (NY025_09060) | 267254..267898 | + | 645 | WP_259423467.1 | DUF6441 family protein | - |
| NY025_RS09065 (NY025_09065) | 267941..268231 | - | 291 | WP_064051869.1 | H-NS family nucleoid-associated regulatory protein | - |
| NY025_RS09070 (NY025_09070) | 268426..269619 | - | 1194 | WP_269436757.1 | YopJ family acetyltransferase | - |
| NY025_RS09075 (NY025_09075) | 270176..270373 | + | 198 | WP_230643628.1 | DUF6441 family protein | - |
| NY025_RS09080 (NY025_09080) | 270378..270791 | - | 414 | WP_259423471.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NY025_RS09085 (NY025_09085) | 270788..271039 | - | 252 | WP_020749302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NY025_RS09090 (NY025_09090) | 271115..275215 | + | 4101 | WP_259423473.1 | tape measure protein | - |
| NY025_RS09095 (NY025_09095) | 275221..275616 | + | 396 | WP_197366418.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 228152..284758 | 56606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15800.23 Da Isoelectric Point: 6.2337
>T256801 WP_259423471.1 NZ_CP103852:c270791-270378 [Ralstonia pseudosolanacearum]
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAVRRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWEM
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAVRRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWEM
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|