Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
| Location | 1049748..1050358 | Replicon | chromosome |
| Accession | NZ_CP103851 | ||
| Organism | Ralstonia pseudosolanacearum strain LMG 9673 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NY025_RS04415 | Protein ID | WP_193029203.1 |
| Coordinates | 1050050..1050358 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NY025_RS04410 | Protein ID | WP_016722339.1 |
| Coordinates | 1049748..1050053 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NY025_RS04390 (NY025_04390) | 1045084..1045281 | + | 198 | Protein_871 | IS5/IS1182 family transposase | - |
| NY025_RS04395 (NY025_04395) | 1045672..1047175 | + | 1504 | Protein_872 | group II intron reverse transcriptase/maturase | - |
| NY025_RS04400 (NY025_04400) | 1047238..1048026 | + | 789 | Protein_873 | IS5 family transposase | - |
| NY025_RS04405 (NY025_04405) | 1048222..1049535 | - | 1314 | WP_193029205.1 | MFS family transporter | - |
| NY025_RS04410 (NY025_04410) | 1049748..1050053 | - | 306 | WP_016722339.1 | putative addiction module antidote protein | Antitoxin |
| NY025_RS04415 (NY025_04415) | 1050050..1050358 | - | 309 | WP_193029203.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NY025_RS04420 (NY025_04420) | 1050434..1051633 | - | 1200 | WP_197366039.1 | MFS transporter | - |
| NY025_RS04425 (NY025_04425) | 1051760..1052575 | - | 816 | WP_197366040.1 | GntR family transcriptional regulator | - |
| NY025_RS04430 (NY025_04430) | 1052753..1053304 | - | 552 | WP_193029197.1 | helix-turn-helix domain-containing protein | - |
| NY025_RS04435 (NY025_04435) | 1053437..1054030 | + | 594 | WP_193029195.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1045672..1050367 | 4695 | |
| - | flank | IS/Tn | - | - | 1047292..1048026 | 734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11783.57 Da Isoelectric Point: 7.1355
>T256799 WP_193029203.1 NZ_CP103851:c1050358-1050050 [Ralstonia pseudosolanacearum]
MLTIRTTEIFDDWFCSLRDKAAQRRIQVRIDRLQMGNPGDMKAVRDGIRELRIDHGPGYRLYVVQHGVVLIVLLCGGDKS
TQEADIRRAIDLSRRLDVDDME
MLTIRTTEIFDDWFCSLRDKAAQRRIQVRIDRLQMGNPGDMKAVRDGIRELRIDHGPGYRLYVVQHGVVLIVLLCGGDKS
TQEADIRRAIDLSRRLDVDDME
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|