Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2156293..2156822 | Replicon | chromosome |
| Accession | NZ_CP103850 | ||
| Organism | Staphylococcus aureus strain NRL 02/947 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NYF25_RS10760 | Protein ID | WP_000621175.1 |
| Coordinates | 2156293..2156655 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | NYF25_RS10765 | Protein ID | WP_000948331.1 |
| Coordinates | 2156652..2156822 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYF25_RS10740 (2153271) | 2153271..2154041 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
| NYF25_RS10745 (2154016) | 2154016..2154495 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| NYF25_RS10750 (2154497) | 2154497..2154823 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| NYF25_RS10755 (2154942) | 2154942..2155943 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| NYF25_RS10760 (2156293) | 2156293..2156655 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NYF25_RS10765 (2156652) | 2156652..2156822 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NYF25_RS10770 (2156907) | 2156907..2158055 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| NYF25_RS10775 (2158121) | 2158121..2158480 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| NYF25_RS10780 (2158484) | 2158484..2158975 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| NYF25_RS10785 (2158962) | 2158962..2160545 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| NYF25_RS10790 (2160538) | 2160538..2161017 | - | 480 | WP_001287088.1 | hypothetical protein | - |
| NYF25_RS10795 (2161225) | 2161225..2161785 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T256793 WP_000621175.1 NZ_CP103850:c2156655-2156293 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|