Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 841498..841975 Replicon chromosome
Accession NZ_CP103850
Organism Staphylococcus aureus strain NRL 02/947

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag NYF25_RS04010 Protein ID WP_000052078.1
Coordinates 841498..841686 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NYF25_RS04015 Protein ID WP_001059690.1
Coordinates 841715..841975 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYF25_RS03980 (837539) 837539..838009 + 471 WP_000824472.1 hypothetical protein -
NYF25_RS03985 (838350) 838350..839036 + 687 WP_001548082.1 thermonuclease family protein -
NYF25_RS03990 (839393) 839393..839593 + 201 WP_001059082.1 cold-shock protein -
NYF25_RS03995 (840089) 840089..840307 - 219 WP_000005886.1 hypothetical protein -
NYF25_RS04000 (840369) 840369..840653 - 285 WP_001004395.1 hypothetical protein -
NYF25_RS04005 (840741) 840741..841310 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NYF25_RS04010 (841498) 841498..841686 - 189 WP_000052078.1 hypothetical protein Toxin
NYF25_RS04015 (841715) 841715..841975 - 261 WP_001059690.1 hypothetical protein Antitoxin
NYF25_RS04020 (842316) 842316..842519 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NYF25_RS04025 (842516) 842516..842752 - 237 WP_000368687.1 hypothetical protein -
NYF25_RS04030 (842977) 842977..843558 + 582 WP_001140686.1 histidine phosphatase family protein -
NYF25_RS04035 (843631) 843631..844248 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
NYF25_RS04040 (844403) 844403..844897 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NYF25_RS04045 (845296) 845296..845718 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NYF25_RS04050 (845866) 845866..846582 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T256787 WP_000052078.1 NZ_CP103850:c841686-841498 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT256787 WP_001059690.1 NZ_CP103850:c841975-841715 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References