Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 2050348..2050837 | Replicon | chromosome |
Accession | NZ_CP103834 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NYR63_RS09590 | Protein ID | WP_279457315.1 |
Coordinates | 2050348..2050608 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NYR63_RS09595 | Protein ID | WP_279457316.1 |
Coordinates | 2050595..2050837 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR63_RS09555 (NYR63_09550) | 2046326..2046601 | + | 276 | WP_005599252.1 | oxidative damage protection protein | - |
NYR63_RS09560 (NYR63_09555) | 2046619..2047716 | + | 1098 | WP_279457314.1 | membrane-bound lytic murein transglycosylase MltC | - |
NYR63_RS09585 (NYR63_09580) | 2048716..2050107 | + | 1392 | WP_005609177.1 | signal recognition particle protein | - |
NYR63_RS09590 (NYR63_09585) | 2050348..2050608 | + | 261 | WP_279457315.1 | BrnT family toxin | Toxin |
NYR63_RS09595 (NYR63_09590) | 2050595..2050837 | + | 243 | WP_279457316.1 | CopG family antitoxin | Antitoxin |
NYR63_RS09600 (NYR63_09595) | 2050915..2052579 | - | 1665 | WP_279457317.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
NYR63_RS09605 (NYR63_09600) | 2052772..2053938 | - | 1167 | WP_279457318.1 | FAD-dependent oxidoreductase | - |
NYR63_RS09610 (NYR63_09605) | 2054144..2055670 | + | 1527 | WP_279457319.1 | YifB family Mg chelatase-like AAA ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2019303..2056883 | 37580 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10343.86 Da Isoelectric Point: 10.1680
>T256786 WP_279457315.1 NZ_CP103834:2050348-2050608 [Actinobacillus genomosp. 1]
MFEYDPNKSRINKEKHGIDFEEAKQLWKDEQLLTFTVMNDPEHRLLAIGQINKKHWSAIFTVRGKNVRLISVRRSRKKEV
ELYENT
MFEYDPNKSRINKEKHGIDFEEAKQLWKDEQLLTFTVMNDPEHRLLAIGQINKKHWSAIFTVRGKNVRLISVRRSRKKEV
ELYENT
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|