Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1569935..1570580 | Replicon | chromosome |
Accession | NZ_CP103834 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | toxT | Uniprot ID | - |
Locus tag | NYR63_RS07225 | Protein ID | WP_279456935.1 |
Coordinates | 1570209..1570580 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR63_RS07220 | Protein ID | WP_279456934.1 |
Coordinates | 1569935..1570228 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR63_RS07190 (NYR63_07185) | 1565262..1565945 | - | 684 | WP_279456929.1 | arginine ABC transporter permease ArtM | - |
NYR63_RS07195 (NYR63_07190) | 1565945..1566616 | - | 672 | WP_005598470.1 | arginine ABC transporter permease ArtQ | - |
NYR63_RS07200 (NYR63_07195) | 1566622..1567341 | - | 720 | WP_279456930.1 | transporter substrate-binding domain-containing protein | - |
NYR63_RS07205 (NYR63_07200) | 1567362..1568096 | - | 735 | WP_279456931.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR63_RS07210 (NYR63_07205) | 1568326..1568823 | - | 498 | WP_279456932.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR63_RS07215 (NYR63_07210) | 1568896..1569858 | + | 963 | WP_279456933.1 | calcium/sodium antiporter | - |
NYR63_RS07220 (NYR63_07215) | 1569935..1570228 | - | 294 | WP_279456934.1 | helix-turn-helix domain-containing protein | Antitoxin |
NYR63_RS07225 (NYR63_07220) | 1570209..1570580 | - | 372 | WP_279456935.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR63_RS07230 (NYR63_07225) | 1570782..1572530 | + | 1749 | WP_279456936.1 | protein-disulfide reductase DsbD | - |
NYR63_RS07235 (NYR63_07230) | 1572590..1573159 | + | 570 | WP_279456937.1 | elongation factor P hydroxylase | - |
NYR63_RS07240 (NYR63_07235) | 1573203..1574057 | - | 855 | WP_279456938.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15024.49 Da Isoelectric Point: 10.2796
>T256783 WP_279456935.1 NZ_CP103834:c1570580-1570209 [Actinobacillus genomosp. 1]
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|