Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 2223676..2224312 | Replicon | chromosome |
Accession | NZ_CP103833 | ||
Organism | Actinobacillus arthritidis strain CCUG24862 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | - |
Locus tag | NYR89_RS10700 | Protein ID | WP_279445790.1 |
Coordinates | 2223941..2224312 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR89_RS10695 | Protein ID | WP_279445789.1 |
Coordinates | 2223676..2223960 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR89_RS10665 (NYR89_10665) | 2219059..2219742 | - | 684 | WP_279445783.1 | arginine ABC transporter permease ArtM | - |
NYR89_RS10670 (NYR89_10670) | 2219742..2220413 | - | 672 | WP_279445784.1 | arginine ABC transporter permease ArtQ | - |
NYR89_RS10675 (NYR89_10675) | 2220419..2221138 | - | 720 | WP_279445785.1 | transporter substrate-binding domain-containing protein | - |
NYR89_RS10680 (NYR89_10680) | 2221158..2221892 | - | 735 | WP_279445786.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR89_RS10685 (NYR89_10685) | 2222089..2222586 | - | 498 | WP_279445788.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR89_RS10690 (NYR89_10690) | 2222660..2223621 | + | 962 | Protein_2059 | calcium/sodium antiporter | - |
NYR89_RS10695 (NYR89_10695) | 2223676..2223960 | - | 285 | WP_279445789.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR89_RS10700 (NYR89_10700) | 2223941..2224312 | - | 372 | WP_279445790.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR89_RS10705 (NYR89_10705) | 2224509..2226257 | + | 1749 | Protein_2062 | protein-disulfide reductase DsbD | - |
NYR89_RS10710 (NYR89_10710) | 2226316..2226885 | + | 570 | WP_279437970.1 | elongation factor P hydroxylase | - |
NYR89_RS10715 (NYR89_10715) | 2226929..2227781 | - | 853 | Protein_2064 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14815.21 Da Isoelectric Point: 10.2812
>T256781 WP_279445790.1 NZ_CP103833:c2224312-2223941 [Actinobacillus arthritidis]
MYEIVFYRDKRGREPVKESLLGLLKQSHNDNREKLQKISHHLSILHLHGTRAGENYIKHLEDRIWQIRPMSDCLLLTSII
RGQFVLLHYLAKSHYRIPKREIERAKSRLADLQARIKDEPYWF
MYEIVFYRDKRGREPVKESLLGLLKQSHNDNREKLQKISHHLSILHLHGTRAGENYIKHLEDRIWQIRPMSDCLLLTSII
RGQFVLLHYLAKSHYRIPKREIERAKSRLADLQARIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|