Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2011505..2012106 | Replicon | chromosome |
| Accession | NZ_CP103833 | ||
| Organism | Actinobacillus arthritidis strain CCUG24862 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NYR89_RS09610 | Protein ID | WP_279445628.1 |
| Coordinates | 2011505..2011972 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NYR89_RS09615 | Protein ID | WP_279445629.1 |
| Coordinates | 2011975..2012106 (-) | Length | 44 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR89_RS09595 (NYR89_09595) | 2007228..2009126 | + | 1899 | WP_279445626.1 | molecular chaperone DnaK | - |
| NYR89_RS09600 (NYR89_09600) | 2009357..2010498 | + | 1142 | Protein_1851 | molecular chaperone DnaJ | - |
| NYR89_RS09605 (NYR89_09605) | 2010541..2011422 | - | 882 | WP_279445627.1 | 50S ribosomal protein L11 methyltransferase | - |
| NYR89_RS09610 (NYR89_09610) | 2011505..2011972 | - | 468 | WP_279445628.1 | GNAT family N-acetyltransferase | Toxin |
| NYR89_RS09615 (NYR89_09615) | 2011975..2012106 | - | 132 | WP_279445629.1 | DUF1778 domain-containing protein | Antitoxin |
| NYR89_RS09620 (NYR89_09620) | 2012072..2012236 | - | 165 | WP_279445630.1 | DUF1778 domain-containing protein | - |
| NYR89_RS09625 (NYR89_09625) | 2012357..2013816 | - | 1460 | Protein_1856 | metalloprotease TldD | - |
| NYR89_RS09630 (NYR89_09630) | 2013988..2015160 | + | 1173 | WP_279445631.1 | DNA-binding transcriptional regulator | - |
| NYR89_RS09635 (NYR89_09635) | 2015253..2016167 | - | 915 | WP_279445632.1 | N-acetylmuramic acid 6-phosphate etherase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17145.09 Da Isoelectric Point: 9.2848
>T256779 WP_279445628.1 NZ_CP103833:c2011972-2011505 [Actinobacillus arthritidis]
MHAPESLSEQHIVRHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDDNKQVMGFYCLSAGSVSRQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPESLSEQHIVRHFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDDNKQVMGFYCLSAGSVSRQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|