Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 762325..762975 | Replicon | chromosome |
Accession | NZ_CP103833 | ||
Organism | Actinobacillus arthritidis strain CCUG24862 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYR89_RS03635 | Protein ID | WP_279446381.1 |
Coordinates | 762325..762714 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BNU4 |
Locus tag | NYR89_RS03640 | Protein ID | WP_005604117.1 |
Coordinates | 762715..762975 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR89_RS03620 (NYR89_03620) | 758094..759290 | + | 1197 | WP_279446378.1 | aspartate/tyrosine/aromatic aminotransferase | - |
NYR89_RS03625 (NYR89_03625) | 759469..760755 | - | 1287 | WP_279446380.1 | Xaa-Pro aminopeptidase | - |
NYR89_RS03630 (NYR89_03630) | 760964..762188 | - | 1225 | Protein_707 | ATP-binding protein | - |
NYR89_RS03635 (NYR89_03635) | 762325..762714 | - | 390 | WP_279446381.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NYR89_RS03640 (NYR89_03640) | 762715..762975 | - | 261 | WP_005604117.1 | hypothetical protein | Antitoxin |
NYR89_RS03645 (NYR89_03645) | 763109..765131 | - | 2023 | Protein_710 | excinuclease ABC subunit UvrB | - |
NYR89_RS03650 (NYR89_03650) | 765308..766120 | + | 813 | WP_279446383.1 | iron uptake system protein EfeO | - |
NYR89_RS03655 (NYR89_03655) | 766135..767327 | + | 1193 | Protein_712 | iron uptake transporter deferrochelatase/peroxidase subunit | - |
NYR89_RS03660 (NYR89_03660) | 767340..767957 | + | 618 | WP_279446384.1 | Fe2+/Pb2+ permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14819.16 Da Isoelectric Point: 5.1421
>T256777 WP_279446381.1 NZ_CP103833:c762714-762325 [Actinobacillus arthritidis]
MYMLDTNTVSYFFRQEPTVVKKLQQLNPELICISSVTVAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQS
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQLIPNLVLENWWK
MYMLDTNTVSYFFRQEPTVVKKLQQLNPELICISSVTVAELFYGVKKRNNQKLTAFLNTFLSAITVMDWDYQVAEVYGQS
RAEMEREGKIMGVQDQMIGAHALATECVLVSSDKAFQLIPNLVLENWWK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|