Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 82274..82983 | Replicon | chromosome |
| Accession | NZ_CP103833 | ||
| Organism | Actinobacillus arthritidis strain CCUG24862 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NYR89_RS00415 | Protein ID | WP_279445875.1 |
| Coordinates | 82561..82983 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NYR89_RS00410 | Protein ID | WP_279445874.1 |
| Coordinates | 82274..82561 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR89_RS00395 (NYR89_00395) | 77410..78591 | + | 1182 | WP_279445871.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| NYR89_RS00400 (NYR89_00400) | 78645..79193 | + | 549 | WP_279445872.1 | type IV pilus biogenesis/stability protein PilW | - |
| NYR89_RS00405 (NYR89_00405) | 79269..81608 | + | 2340 | WP_279445873.1 | Tex family protein | - |
| NYR89_RS00410 (NYR89_00410) | 82274..82561 | + | 288 | WP_279445874.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NYR89_RS00415 (NYR89_00415) | 82561..82983 | + | 423 | WP_279445875.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYR89_RS00420 (NYR89_00420) | 83493..84773 | - | 1281 | WP_279446679.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NYR89_RS00425 (NYR89_00425) | 84883..85401 | - | 519 | WP_279445876.1 | SprT family zinc-dependent metalloprotease | - |
| NYR89_RS00430 (NYR89_00430) | 85402..86171 | - | 770 | Protein_78 | ribonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16264.13 Da Isoelectric Point: 9.3983
>T256776 WP_279445875.1 NZ_CP103833:82561-82983 [Actinobacillus arthritidis]
MYLLDTNIVSELRKMESGKVDANVVKWFQQVNLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPNFENRI
LPLDTKVMMTCAEFHIPDKKPLNDSYIAATAKAHRFKIVTRNVKDFKGCGVEVLNPFIEY
MYLLDTNIVSELRKMESGKVDANVVKWFQQVNLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPNFENRI
LPLDTKVMMTCAEFHIPDKKPLNDSYIAATAKAHRFKIVTRNVKDFKGCGVEVLNPFIEY
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|