Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2322940..2323582 | Replicon | chromosome |
Accession | NZ_CP103831 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 1812 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR87_RS10830 | Protein ID | WP_005621659.1 |
Coordinates | 2322940..2323311 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR87_RS10835 | Protein ID | WP_039198813.1 |
Coordinates | 2323292..2323582 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR87_RS10815 (NYR87_10810) | 2319447..2320301 | + | 855 | WP_279437193.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR87_RS10820 (NYR87_10815) | 2320345..2320914 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
NYR87_RS10825 (NYR87_10820) | 2320974..2322722 | - | 1749 | WP_279481014.1 | protein-disulfide reductase DsbD | - |
NYR87_RS10830 (NYR87_10825) | 2322940..2323311 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR87_RS10835 (NYR87_10830) | 2323292..2323582 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR87_RS10840 (NYR87_10835) | 2323650..2324612 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR87_RS10845 (NYR87_10840) | 2324685..2325182 | + | 498 | WP_279481016.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR87_RS10850 (NYR87_10845) | 2325406..2326140 | + | 735 | WP_279438545.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR87_RS10855 (NYR87_10850) | 2326161..2326880 | + | 720 | WP_279481020.1 | transporter substrate-binding domain-containing protein | - |
NYR87_RS10860 (NYR87_10855) | 2326886..2327557 | + | 672 | WP_279481023.1 | arginine ABC transporter permease ArtQ | - |
NYR87_RS10865 (NYR87_10860) | 2327557..2328240 | + | 684 | WP_279443240.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256771 WP_005621659.1 NZ_CP103831:2322940-2323311 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|