Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/NGN_SP-YefM |
| Location | 67225..67934 | Replicon | chromosome |
| Accession | NZ_CP103831 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 1812 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NYR87_RS00350 | Protein ID | WP_279481151.1 |
| Coordinates | 67512..67934 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NYR87_RS00345 | Protein ID | WP_279481148.1 |
| Coordinates | 67225..67512 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR87_RS00330 (NYR87_00330) | 62756..63937 | + | 1182 | WP_278225213.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| NYR87_RS00335 (NYR87_00335) | 63991..64539 | + | 549 | WP_279481145.1 | type IV pilus biogenesis/stability protein PilW | - |
| NYR87_RS00340 (NYR87_00340) | 64615..66954 | + | 2340 | WP_279481146.1 | Tex family protein | - |
| NYR87_RS00345 (NYR87_00345) | 67225..67512 | + | 288 | WP_279481148.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NYR87_RS00350 (NYR87_00350) | 67512..67934 | + | 423 | WP_279481151.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYR87_RS00355 (NYR87_00355) | 68041..69321 | - | 1281 | WP_279471384.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NYR87_RS00360 (NYR87_00360) | 69433..69951 | - | 519 | WP_278225217.1 | SprT family zinc-dependent metalloprotease | - |
| NYR87_RS00365 (NYR87_00365) | 69952..70722 | - | 771 | WP_279481152.1 | ribonuclease | - |
| NYR87_RS00370 (NYR87_00370) | 70843..72699 | - | 1857 | WP_279481154.1 | signal peptide peptidase SppA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16131.92 Da Isoelectric Point: 9.4570
>T256768 WP_279481151.1 NZ_CP103831:67512-67934 [Actinobacillus equuli subsp. haemolyticus]
MYLLDTNIVSELRKMESGKADVNVVKWFQQINLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPNFENRI
LPLDSKVMMTCAEFHIPDKKPLNDSYIAATAKAHRFKIVSRNVKDFKGCGVEVLNPFAES
MYLLDTNIVSELRKMESGKADVNVVKWFQQINLTDAYLSVITLFEIKLGILQLKRKDIQQAKLLQSWFEQKLLPNFENRI
LPLDSKVMMTCAEFHIPDKKPLNDSYIAATAKAHRFKIVSRNVKDFKGCGVEVLNPFAES
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|