Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2336614..2337256 | Replicon | chromosome |
Accession | NZ_CP103830 | ||
Organism | Actinobacillus equuli subsp. equuli strain 2499 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR86_RS10750 | Protein ID | WP_005621659.1 |
Coordinates | 2336614..2336985 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR86_RS10755 | Protein ID | WP_039198813.1 |
Coordinates | 2336966..2337256 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR86_RS10735 (NYR86_10735) | 2333123..2333977 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR86_RS10740 (NYR86_10740) | 2334021..2334590 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
NYR86_RS10745 (NYR86_10745) | 2334648..2336396 | - | 1749 | WP_279623287.1 | protein-disulfide reductase DsbD | - |
NYR86_RS10750 (NYR86_10750) | 2336614..2336985 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR86_RS10755 (NYR86_10755) | 2336966..2337256 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR86_RS10760 (NYR86_10760) | 2337324..2338286 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR86_RS10765 (NYR86_10765) | 2338359..2338856 | + | 498 | WP_278226779.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR86_RS10770 (NYR86_10770) | 2339081..2339815 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR86_RS10775 (NYR86_10775) | 2339835..2340554 | + | 720 | WP_279443239.1 | transporter substrate-binding domain-containing protein | - |
NYR86_RS10780 (NYR86_10780) | 2340560..2341231 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
NYR86_RS10785 (NYR86_10785) | 2341231..2341914 | + | 684 | WP_279623288.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256767 WP_005621659.1 NZ_CP103830:2336614-2336985 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|