Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2267650..2268292 | Replicon | chromosome |
Accession | NZ_CP103829 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 2863 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR66_RS10620 | Protein ID | WP_005621659.1 |
Coordinates | 2267650..2268021 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR66_RS10625 | Protein ID | WP_039198813.1 |
Coordinates | 2268002..2268292 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR66_RS10605 (NYR66_10610) | 2264157..2265011 | + | 855 | WP_275217246.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR66_RS10610 (NYR66_10615) | 2265055..2265624 | - | 570 | WP_115587467.1 | elongation factor P hydroxylase | - |
NYR66_RS10615 (NYR66_10620) | 2265684..2267432 | - | 1749 | WP_279456036.1 | protein-disulfide reductase DsbD | - |
NYR66_RS10620 (NYR66_10625) | 2267650..2268021 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR66_RS10625 (NYR66_10630) | 2268002..2268292 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR66_RS10630 (NYR66_10635) | 2268360..2269322 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR66_RS10635 (NYR66_10640) | 2269395..2269892 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR66_RS10640 (NYR66_10645) | 2270117..2270851 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR66_RS10645 (NYR66_10650) | 2270871..2271590 | + | 720 | WP_279456037.1 | transporter substrate-binding domain-containing protein | - |
NYR66_RS10650 (NYR66_10655) | 2271596..2272267 | + | 672 | WP_279456038.1 | arginine ABC transporter permease ArtQ | - |
NYR66_RS10655 (NYR66_10660) | 2272267..2272950 | + | 684 | WP_279456039.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256765 WP_005621659.1 NZ_CP103829:2267650-2268021 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|