Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2286834..2287476 | Replicon | chromosome |
| Accession | NZ_CP103828 | ||
| Organism | Actinobacillus equuli subsp. equuli strain 3009 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR83_RS10560 | Protein ID | WP_005621659.1 |
| Coordinates | 2286834..2287205 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR83_RS10565 | Protein ID | WP_039198813.1 |
| Coordinates | 2287186..2287476 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR83_RS10545 (NYR83_10545) | 2283342..2284196 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR83_RS10550 (NYR83_10550) | 2284240..2284809 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
| NYR83_RS10555 (NYR83_10555) | 2284868..2286616 | - | 1749 | WP_279443238.1 | protein-disulfide reductase DsbD | - |
| NYR83_RS10560 (NYR83_10560) | 2286834..2287205 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR83_RS10565 (NYR83_10565) | 2287186..2287476 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR83_RS10570 (NYR83_10570) | 2287544..2288506 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
| NYR83_RS10575 (NYR83_10575) | 2288579..2289076 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR83_RS10580 (NYR83_10580) | 2289301..2290035 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR83_RS10585 (NYR83_10585) | 2290055..2290774 | + | 720 | WP_279443239.1 | transporter substrate-binding domain-containing protein | - |
| NYR83_RS10590 (NYR83_10590) | 2290780..2291451 | + | 672 | WP_278226783.1 | arginine ABC transporter permease ArtQ | - |
| NYR83_RS10595 (NYR83_10595) | 2291451..2292134 | + | 684 | WP_279443240.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256762 WP_005621659.1 NZ_CP103828:2286834-2287205 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|