Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2300724..2301366 | Replicon | chromosome |
Accession | NZ_CP103827 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 3090 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR82_RS10840 | Protein ID | WP_005621659.1 |
Coordinates | 2300724..2301095 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR82_RS10845 | Protein ID | WP_039198813.1 |
Coordinates | 2301076..2301366 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR82_RS10825 (NYR82_10830) | 2297231..2298085 | + | 855 | WP_279442033.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR82_RS10830 (NYR82_10835) | 2298129..2298698 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
NYR82_RS10835 (NYR82_10840) | 2298758..2300506 | - | 1749 | WP_279442034.1 | protein-disulfide reductase DsbD | - |
NYR82_RS10840 (NYR82_10845) | 2300724..2301095 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR82_RS10845 (NYR82_10850) | 2301076..2301366 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR82_RS10850 (NYR82_10855) | 2301434..2302396 | - | 963 | WP_279442035.1 | calcium/sodium antiporter | - |
NYR82_RS10855 (NYR82_10860) | 2302469..2302966 | + | 498 | WP_015674483.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR82_RS10860 (NYR82_10865) | 2303189..2303923 | + | 735 | WP_279442036.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR82_RS10865 (NYR82_10870) | 2303944..2304663 | + | 720 | WP_279442037.1 | transporter substrate-binding domain-containing protein | - |
NYR82_RS10870 (NYR82_10875) | 2304669..2305340 | + | 672 | WP_015674486.1 | arginine ABC transporter permease ArtQ | - |
NYR82_RS10875 (NYR82_10880) | 2305340..2306023 | + | 684 | WP_279442038.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256760 WP_005621659.1 NZ_CP103827:2300724-2301095 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|