Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 922963..923576 Replicon chromosome
Accession NZ_CP103827
Organism Actinobacillus equuli subsp. haemolyticus strain 3090

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NYR82_RS04255 Protein ID WP_115590007.1
Coordinates 923394..923576 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NYR82_RS04250 Protein ID WP_279442609.1
Coordinates 922963..923370 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR82_RS04210 (NYR82_04215) 918280..918534 + 255 WP_279442603.1 DNA helicase UvrD -
NYR82_RS04215 (NYR82_04220) 918639..919832 + 1194 WP_279442604.1 phage tail sheath protein -
NYR82_RS04220 (NYR82_04225) 919835..920341 + 507 WP_279442605.1 phage major tail tube protein -
NYR82_RS04225 (NYR82_04230) 920398..920694 + 297 WP_279442606.1 phage tail assembly protein -
NYR82_RS04230 (NYR82_04235) 920724..920840 + 117 WP_279442785.1 GpE family phage tail protein -
NYR82_RS04235 (NYR82_04240) 920899..921336 + 438 WP_279442607.1 phage tail protein -
NYR82_RS04240 (NYR82_04245) 921339..922562 + 1224 WP_279442786.1 phage late control D family protein -
NYR82_RS04245 (NYR82_04250) 922559..922951 - 393 WP_279442608.1 hypothetical protein -
NYR82_RS04250 (NYR82_04255) 922963..923370 - 408 WP_279442609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NYR82_RS04255 (NYR82_04260) 923394..923576 - 183 WP_115590007.1 type II toxin-antitoxin system HicA family toxin Toxin
NYR82_RS04260 (NYR82_04265) 923892..924581 - 690 WP_279442610.1 S24 family peptidase -
NYR82_RS04265 (NYR82_04270) 924733..924933 + 201 WP_279442611.1 Cro/CI family transcriptional regulator -
NYR82_RS04270 (NYR82_04275) 924926..925060 + 135 WP_279442612.1 hypothetical protein -
NYR82_RS04275 (NYR82_04280) 925031..925393 - 363 WP_279442613.1 hypothetical protein -
NYR82_RS04280 (NYR82_04285) 925593..925838 + 246 WP_279442614.1 hypothetical protein -
NYR82_RS04285 (NYR82_04290) 925927..926253 + 327 WP_279442615.1 hypothetical protein -
NYR82_RS04290 (NYR82_04295) 926256..926711 + 456 WP_279442616.1 hypothetical protein -
NYR82_RS04295 (NYR82_04300) 926829..927008 + 180 WP_279442617.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 893610..932814 39204
- inside Prophage - - 893610..934831 41221


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6771.88 Da        Isoelectric Point: 10.9132

>T256757 WP_115590007.1 NZ_CP103827:c923576-923394 [Actinobacillus equuli subsp. haemolyticus]
VTSAELIKLIESDGWYRVNIAGSHHQFKHPTKKGRVTIPHPKKDLNIKTQNSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 15127.14 Da        Isoelectric Point: 4.4693

>AT256757 WP_279442609.1 NZ_CP103827:c923370-922963 [Actinobacillus equuli subsp. haemolyticus]
MLYPIAIELGDEKHAYGVVVPDVPGCFSAGDTIEEAFQNAKEAIPFHIEGMLEDGEEIPQPTSIDTHRNNPDYEGFMWSV
VDVDLTHLMGKSEKLNITLPSLLIKRIDEFVARHPDYKNRSNFLAKVATDRLLSA

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References