Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2301051..2301693 | Replicon | chromosome |
| Accession | NZ_CP103826 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 3113 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR81_RS10865 | Protein ID | WP_005621659.1 |
| Coordinates | 2301051..2301422 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR81_RS10870 | Protein ID | WP_039198813.1 |
| Coordinates | 2301403..2301693 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR81_RS10850 (NYR81_10850) | 2297557..2298411 | + | 855 | WP_279442033.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR81_RS10855 (NYR81_10855) | 2298455..2299024 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
| NYR81_RS10860 (NYR81_10860) | 2299084..2300833 | - | 1750 | Protein_2084 | protein-disulfide reductase DsbD | - |
| NYR81_RS10865 (NYR81_10865) | 2301051..2301422 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR81_RS10870 (NYR81_10870) | 2301403..2301693 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR81_RS10875 (NYR81_10875) | 2301761..2302723 | - | 963 | WP_279442035.1 | calcium/sodium antiporter | - |
| NYR81_RS10880 (NYR81_10880) | 2302796..2303293 | + | 498 | WP_015674483.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR81_RS10885 (NYR81_10885) | 2303516..2304250 | + | 735 | WP_279442036.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR81_RS10890 (NYR81_10890) | 2304271..2304990 | + | 720 | WP_279442037.1 | transporter substrate-binding domain-containing protein | - |
| NYR81_RS10895 (NYR81_10895) | 2304996..2305667 | + | 672 | WP_015674486.1 | arginine ABC transporter permease ArtQ | - |
| NYR81_RS10900 (NYR81_10900) | 2305667..2306350 | + | 684 | WP_279442038.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256755 WP_005621659.1 NZ_CP103826:2301051-2301422 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|