Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 821932..822545 | Replicon | chromosome |
| Accession | NZ_CP103826 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 3113 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NYR81_RS03760 | Protein ID | WP_115590007.1 |
| Coordinates | 821932..822114 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NYR81_RS03765 | Protein ID | WP_279442609.1 |
| Coordinates | 822138..822545 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR81_RS03725 (NYR81_03725) | 818797..819252 | - | 456 | WP_279442616.1 | hypothetical protein | - |
| NYR81_RS03730 (NYR81_03730) | 819255..819581 | - | 327 | WP_279442615.1 | hypothetical protein | - |
| NYR81_RS03735 (NYR81_03735) | 819670..819915 | - | 246 | WP_279442614.1 | hypothetical protein | - |
| NYR81_RS03740 (NYR81_03740) | 820115..820477 | + | 363 | WP_279442613.1 | hypothetical protein | - |
| NYR81_RS03745 (NYR81_03745) | 820448..820582 | - | 135 | WP_279442612.1 | hypothetical protein | - |
| NYR81_RS03750 (NYR81_03750) | 820575..820775 | - | 201 | WP_279442611.1 | Cro/CI family transcriptional regulator | - |
| NYR81_RS03755 (NYR81_03755) | 820927..821616 | + | 690 | WP_279479703.1 | S24 family peptidase | - |
| NYR81_RS03760 (NYR81_03760) | 821932..822114 | + | 183 | WP_115590007.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NYR81_RS03765 (NYR81_03765) | 822138..822545 | + | 408 | WP_279442609.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NYR81_RS03770 (NYR81_03770) | 822557..822949 | + | 393 | WP_279479705.1 | hypothetical protein | - |
| NYR81_RS03775 (NYR81_03775) | 822946..824169 | - | 1224 | WP_279442786.1 | phage late control D family protein | - |
| NYR81_RS03780 (NYR81_03780) | 824172..824609 | - | 438 | WP_279479707.1 | phage tail protein | - |
| NYR81_RS03785 (NYR81_03785) | 824668..824784 | - | 117 | WP_279442785.1 | GpE family phage tail protein | - |
| NYR81_RS03790 (NYR81_03790) | 824814..825110 | - | 297 | WP_279442606.1 | phage tail assembly protein | - |
| NYR81_RS03795 (NYR81_03795) | 825167..825673 | - | 507 | WP_279442605.1 | phage major tail tube protein | - |
| NYR81_RS03800 (NYR81_03800) | 825676..826869 | - | 1194 | WP_279442604.1 | phage tail sheath protein | - |
| NYR81_RS03805 (NYR81_03805) | 826974..827228 | - | 255 | WP_279479709.1 | DNA helicase UvrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 812695..847536 | 34841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6771.88 Da Isoelectric Point: 10.9132
>T256751 WP_115590007.1 NZ_CP103826:821932-822114 [Actinobacillus equuli subsp. haemolyticus]
VTSAELIKLIESDGWYRVNIAGSHHQFKHPTKKGRVTIPHPKKDLNIKTQNSILKQAGLK
VTSAELIKLIESDGWYRVNIAGSHHQFKHPTKKGRVTIPHPKKDLNIKTQNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15127.14 Da Isoelectric Point: 4.4693
>AT256751 WP_279442609.1 NZ_CP103826:822138-822545 [Actinobacillus equuli subsp. haemolyticus]
MLYPIAIELGDEKHAYGVVVPDVPGCFSAGDTIEEAFQNAKEAIPFHIEGMLEDGEEIPQPTSIDTHRNNPDYEGFMWSV
VDVDLTHLMGKSEKLNITLPSLLIKRIDEFVARHPDYKNRSNFLAKVATDRLLSA
MLYPIAIELGDEKHAYGVVVPDVPGCFSAGDTIEEAFQNAKEAIPFHIEGMLEDGEEIPQPTSIDTHRNNPDYEGFMWSV
VDVDLTHLMGKSEKLNITLPSLLIKRIDEFVARHPDYKNRSNFLAKVATDRLLSA
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|