Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 821932..822545 Replicon chromosome
Accession NZ_CP103826
Organism Actinobacillus equuli subsp. haemolyticus strain 3113

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NYR81_RS03760 Protein ID WP_115590007.1
Coordinates 821932..822114 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NYR81_RS03765 Protein ID WP_279442609.1
Coordinates 822138..822545 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR81_RS03725 (NYR81_03725) 818797..819252 - 456 WP_279442616.1 hypothetical protein -
NYR81_RS03730 (NYR81_03730) 819255..819581 - 327 WP_279442615.1 hypothetical protein -
NYR81_RS03735 (NYR81_03735) 819670..819915 - 246 WP_279442614.1 hypothetical protein -
NYR81_RS03740 (NYR81_03740) 820115..820477 + 363 WP_279442613.1 hypothetical protein -
NYR81_RS03745 (NYR81_03745) 820448..820582 - 135 WP_279442612.1 hypothetical protein -
NYR81_RS03750 (NYR81_03750) 820575..820775 - 201 WP_279442611.1 Cro/CI family transcriptional regulator -
NYR81_RS03755 (NYR81_03755) 820927..821616 + 690 WP_279479703.1 S24 family peptidase -
NYR81_RS03760 (NYR81_03760) 821932..822114 + 183 WP_115590007.1 type II toxin-antitoxin system HicA family toxin Toxin
NYR81_RS03765 (NYR81_03765) 822138..822545 + 408 WP_279442609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NYR81_RS03770 (NYR81_03770) 822557..822949 + 393 WP_279479705.1 hypothetical protein -
NYR81_RS03775 (NYR81_03775) 822946..824169 - 1224 WP_279442786.1 phage late control D family protein -
NYR81_RS03780 (NYR81_03780) 824172..824609 - 438 WP_279479707.1 phage tail protein -
NYR81_RS03785 (NYR81_03785) 824668..824784 - 117 WP_279442785.1 GpE family phage tail protein -
NYR81_RS03790 (NYR81_03790) 824814..825110 - 297 WP_279442606.1 phage tail assembly protein -
NYR81_RS03795 (NYR81_03795) 825167..825673 - 507 WP_279442605.1 phage major tail tube protein -
NYR81_RS03800 (NYR81_03800) 825676..826869 - 1194 WP_279442604.1 phage tail sheath protein -
NYR81_RS03805 (NYR81_03805) 826974..827228 - 255 WP_279479709.1 DNA helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 812695..847536 34841


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6771.88 Da        Isoelectric Point: 10.9132

>T256751 WP_115590007.1 NZ_CP103826:821932-822114 [Actinobacillus equuli subsp. haemolyticus]
VTSAELIKLIESDGWYRVNIAGSHHQFKHPTKKGRVTIPHPKKDLNIKTQNSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 15127.14 Da        Isoelectric Point: 4.4693

>AT256751 WP_279442609.1 NZ_CP103826:822138-822545 [Actinobacillus equuli subsp. haemolyticus]
MLYPIAIELGDEKHAYGVVVPDVPGCFSAGDTIEEAFQNAKEAIPFHIEGMLEDGEEIPQPTSIDTHRNNPDYEGFMWSV
VDVDLTHLMGKSEKLNITLPSLLIKRIDEFVARHPDYKNRSNFLAKVATDRLLSA

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References