Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2310263..2310905 | Replicon | chromosome |
Accession | NZ_CP103825 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 3282 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR80_RS10710 | Protein ID | WP_005621659.1 |
Coordinates | 2310263..2310634 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR80_RS10715 | Protein ID | WP_039198813.1 |
Coordinates | 2310615..2310905 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR80_RS10695 (NYR80_10700) | 2306770..2307624 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR80_RS10700 (NYR80_10705) | 2307668..2308237 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
NYR80_RS10705 (NYR80_10710) | 2308297..2310045 | - | 1749 | WP_279438543.1 | protein-disulfide reductase DsbD | - |
NYR80_RS10710 (NYR80_10715) | 2310263..2310634 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR80_RS10715 (NYR80_10720) | 2310615..2310905 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR80_RS10720 (NYR80_10725) | 2310973..2311935 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR80_RS10725 (NYR80_10730) | 2312008..2312505 | + | 498 | WP_279438544.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR80_RS10730 (NYR80_10735) | 2312730..2313464 | + | 735 | WP_279438545.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR80_RS10735 (NYR80_10740) | 2313485..2314204 | + | 720 | WP_279438546.1 | transporter substrate-binding domain-containing protein | - |
NYR80_RS10740 (NYR80_10745) | 2314210..2314881 | + | 672 | WP_015674486.1 | arginine ABC transporter permease ArtQ | - |
NYR80_RS10745 (NYR80_10750) | 2314881..2315564 | + | 684 | WP_279438547.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256750 WP_005621659.1 NZ_CP103825:2310263-2310634 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|