Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2314239..2314881 | Replicon | chromosome |
| Accession | NZ_CP103821 | ||
| Organism | Actinobacillus equuli subsp. equuli strain 3750 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR76_RS10755 | Protein ID | WP_005621659.1 |
| Coordinates | 2314239..2314610 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR76_RS10760 | Protein ID | WP_039198813.1 |
| Coordinates | 2314591..2314881 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR76_RS10740 (NYR76_10740) | 2310747..2311601 | + | 855 | WP_279478289.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR76_RS10745 (NYR76_10745) | 2311645..2312214 | - | 570 | WP_279478872.1 | elongation factor P hydroxylase | - |
| NYR76_RS10750 (NYR76_10750) | 2312273..2314021 | - | 1749 | WP_279478290.1 | protein-disulfide reductase DsbD | - |
| NYR76_RS10755 (NYR76_10755) | 2314239..2314610 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR76_RS10760 (NYR76_10760) | 2314591..2314881 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR76_RS10765 (NYR76_10765) | 2314949..2315911 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
| NYR76_RS10770 (NYR76_10770) | 2315984..2316481 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR76_RS10775 (NYR76_10775) | 2316706..2317440 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR76_RS10780 (NYR76_10780) | 2317460..2318179 | + | 720 | WP_279443239.1 | transporter substrate-binding domain-containing protein | - |
| NYR76_RS10785 (NYR76_10785) | 2318185..2318856 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
| NYR76_RS10790 (NYR76_10790) | 2318856..2319539 | + | 684 | WP_279478291.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256739 WP_005621659.1 NZ_CP103821:2314239-2314610 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|