Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 1270409..1271051 | Replicon | chromosome |
| Accession | NZ_CP103819 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 3873 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR74_RS05780 | Protein ID | WP_005621659.1 |
| Coordinates | 1270680..1271051 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR74_RS05775 | Protein ID | WP_039198813.1 |
| Coordinates | 1270409..1270699 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR74_RS05745 (NYR74_05745) | 1265773..1266456 | - | 684 | WP_279453445.1 | arginine ABC transporter permease ArtM | - |
| NYR74_RS05750 (NYR74_05750) | 1266456..1267127 | - | 672 | WP_275217250.1 | arginine ABC transporter permease ArtQ | - |
| NYR74_RS05755 (NYR74_05755) | 1267133..1267852 | - | 720 | WP_279453444.1 | transporter substrate-binding domain-containing protein | - |
| NYR74_RS05760 (NYR74_05760) | 1267873..1268607 | - | 735 | WP_279438545.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR74_RS05765 (NYR74_05765) | 1268808..1269306 | - | 499 | Protein_1127 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR74_RS05770 (NYR74_05770) | 1269379..1270341 | + | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
| NYR74_RS05775 (NYR74_05775) | 1270409..1270699 | - | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR74_RS05780 (NYR74_05780) | 1270680..1271051 | - | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR74_RS05785 (NYR74_05785) | 1271269..1273020 | + | 1752 | WP_279453442.1 | protein-disulfide reductase DsbD | - |
| NYR74_RS05790 (NYR74_05790) | 1273079..1273648 | + | 570 | WP_279441422.1 | elongation factor P hydroxylase | - |
| NYR74_RS05795 (NYR74_05795) | 1273692..1274546 | - | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256731 WP_005621659.1 NZ_CP103819:c1271051-1270680 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10821.59 Da Isoelectric Point: 8.7275
>AT256731 WP_039198813.1 NZ_CP103819:c1270699-1270409 [Actinobacillus equuli subsp. haemolyticus]
MSPIGSSWTSFEREVFNELEMEENHFRVKLILEIIETRQALGISQRKLEKLSGVKQSMIARIEKGSSNPSLGTLLKLLVP
LGKTLQIVSLDETHSK
MSPIGSSWTSFEREVFNELEMEENHFRVKLILEIIETRQALGISQRKLEKLSGVKQSMIARIEKGSSNPSLGTLLKLLVP
LGKTLQIVSLDETHSK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|