Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2321134..2321776 | Replicon | chromosome |
Accession | NZ_CP103818 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 3874 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR73_RS10880 | Protein ID | WP_005621659.1 |
Coordinates | 2321134..2321505 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR73_RS10885 | Protein ID | WP_039198813.1 |
Coordinates | 2321486..2321776 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR73_RS10865 (NYR73_10875) | 2317639..2318493 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR73_RS10870 (NYR73_10880) | 2318537..2319106 | - | 570 | WP_279441422.1 | elongation factor P hydroxylase | - |
NYR73_RS10875 (NYR73_10885) | 2319165..2320916 | - | 1752 | WP_279453442.1 | protein-disulfide reductase DsbD | - |
NYR73_RS10880 (NYR73_10890) | 2321134..2321505 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR73_RS10885 (NYR73_10895) | 2321486..2321776 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR73_RS10890 (NYR73_10900) | 2321844..2322806 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR73_RS10895 (NYR73_10905) | 2322879..2323376 | + | 498 | WP_279453443.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR73_RS10900 (NYR73_10910) | 2323577..2324311 | + | 735 | WP_279438545.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR73_RS10905 (NYR73_10915) | 2324332..2325051 | + | 720 | WP_279453444.1 | transporter substrate-binding domain-containing protein | - |
NYR73_RS10910 (NYR73_10920) | 2325057..2325728 | + | 672 | WP_275217250.1 | arginine ABC transporter permease ArtQ | - |
NYR73_RS10915 (NYR73_10925) | 2325728..2326411 | + | 684 | WP_279453445.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256729 WP_005621659.1 NZ_CP103818:2321134-2321505 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|