Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2281575..2282217 | Replicon | chromosome |
Accession | NZ_CP103817 | ||
Organism | Actinobacillus equuli subsp. equuli strain 4005 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR71_RS10535 | Protein ID | WP_005621659.1 |
Coordinates | 2281575..2281946 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR71_RS10540 | Protein ID | WP_039198813.1 |
Coordinates | 2281927..2282217 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR71_RS10520 (NYR71_10520) | 2278082..2278936 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR71_RS10525 (NYR71_10525) | 2278980..2279549 | - | 570 | WP_115587467.1 | elongation factor P hydroxylase | - |
NYR71_RS10530 (NYR71_10530) | 2279609..2281357 | - | 1749 | WP_279439678.1 | protein-disulfide reductase DsbD | - |
NYR71_RS10535 (NYR71_10535) | 2281575..2281946 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR71_RS10540 (NYR71_10540) | 2281927..2282217 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR71_RS10545 (NYR71_10545) | 2282285..2283247 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR71_RS10550 (NYR71_10550) | 2283320..2283817 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR71_RS10555 (NYR71_10555) | 2284042..2284776 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR71_RS10560 (NYR71_10560) | 2284796..2285515 | + | 720 | WP_039198822.1 | transporter substrate-binding domain-containing protein | - |
NYR71_RS10565 (NYR71_10565) | 2285521..2286192 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
NYR71_RS10570 (NYR71_10570) | 2286192..2286875 | + | 684 | WP_039198827.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256724 WP_005621659.1 NZ_CP103817:2281575-2281946 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|