Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2278865..2279507 | Replicon | chromosome |
Accession | NZ_CP103816 | ||
Organism | Actinobacillus equuli subsp. equuli strain 4026 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR70_RS10540 | Protein ID | WP_005621659.1 |
Coordinates | 2278865..2279236 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR70_RS10545 | Protein ID | WP_039198813.1 |
Coordinates | 2279217..2279507 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR70_RS10525 (NYR70_10525) | 2275373..2276227 | + | 855 | WP_279477229.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR70_RS10530 (NYR70_10530) | 2276271..2276840 | - | 570 | WP_279437970.1 | elongation factor P hydroxylase | - |
NYR70_RS10535 (NYR70_10535) | 2276899..2278647 | - | 1749 | WP_279477230.1 | protein-disulfide reductase DsbD | - |
NYR70_RS10540 (NYR70_10540) | 2278865..2279236 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR70_RS10545 (NYR70_10545) | 2279217..2279507 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR70_RS10550 (NYR70_10550) | 2279575..2280537 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR70_RS10555 (NYR70_10555) | 2280610..2281107 | + | 498 | WP_278226779.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR70_RS10560 (NYR70_10560) | 2281332..2282066 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR70_RS10565 (NYR70_10565) | 2282086..2282805 | + | 720 | WP_279443239.1 | transporter substrate-binding domain-containing protein | - |
NYR70_RS10570 (NYR70_10570) | 2282811..2283482 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
NYR70_RS10575 (NYR70_10575) | 2283482..2284165 | + | 684 | WP_279477231.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256722 WP_005621659.1 NZ_CP103816:2278865-2279236 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|