Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2350151..2350793 | Replicon | chromosome |
Accession | NZ_CP103815 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 4038 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR69_RS11020 | Protein ID | WP_005621659.1 |
Coordinates | 2350151..2350522 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR69_RS11025 | Protein ID | WP_039198813.1 |
Coordinates | 2350503..2350793 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR69_RS11005 (NYR69_11010) | 2346658..2347512 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR69_RS11010 (NYR69_11015) | 2347556..2348125 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
NYR69_RS11015 (NYR69_11020) | 2348185..2349933 | - | 1749 | WP_279438543.1 | protein-disulfide reductase DsbD | - |
NYR69_RS11020 (NYR69_11025) | 2350151..2350522 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR69_RS11025 (NYR69_11030) | 2350503..2350793 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR69_RS11030 (NYR69_11035) | 2350861..2351823 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR69_RS11035 (NYR69_11040) | 2351896..2352393 | + | 498 | WP_279438544.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR69_RS11040 (NYR69_11045) | 2352618..2353352 | + | 735 | WP_279438545.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR69_RS11045 (NYR69_11050) | 2353373..2354092 | + | 720 | WP_279438546.1 | transporter substrate-binding domain-containing protein | - |
NYR69_RS11050 (NYR69_11055) | 2354098..2354769 | + | 672 | WP_015674486.1 | arginine ABC transporter permease ArtQ | - |
NYR69_RS11055 (NYR69_11060) | 2354769..2355452 | + | 684 | WP_279438547.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256720 WP_005621659.1 NZ_CP103815:2350151-2350522 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|