Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2345709..2346351 | Replicon | chromosome |
| Accession | NZ_CP103812 | ||
| Organism | Actinobacillus equuli subsp. haemolyticus strain 3826 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR84_RS10880 | Protein ID | WP_005621659.1 |
| Coordinates | 2345709..2346080 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR84_RS10885 | Protein ID | WP_279469954.1 |
| Coordinates | 2346061..2346351 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR84_RS10865 (NYR84_10865) | 2342216..2343070 | + | 855 | WP_279469952.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR84_RS10870 (NYR84_10870) | 2343114..2343683 | - | 570 | WP_115587467.1 | elongation factor P hydroxylase | - |
| NYR84_RS10875 (NYR84_10875) | 2343743..2345491 | - | 1749 | WP_279469953.1 | protein-disulfide reductase DsbD | - |
| NYR84_RS10880 (NYR84_10880) | 2345709..2346080 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR84_RS10885 (NYR84_10885) | 2346061..2346351 | + | 291 | WP_279469954.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR84_RS10890 (NYR84_10890) | 2346419..2347381 | - | 963 | WP_279469955.1 | calcium/sodium antiporter | - |
| NYR84_RS10895 (NYR84_10895) | 2347454..2347951 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR84_RS10900 (NYR84_10900) | 2348176..2348910 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR84_RS10905 (NYR84_10905) | 2348930..2349649 | + | 720 | WP_279469956.1 | transporter substrate-binding domain-containing protein | - |
| NYR84_RS10910 (NYR84_10910) | 2349655..2350326 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
| NYR84_RS10915 (NYR84_10915) | 2350326..2351009 | + | 684 | WP_279455017.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256709 WP_005621659.1 NZ_CP103812:2345709-2346080 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|