Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 2360342..2360984 | Replicon | chromosome |
| Accession | NZ_CP103811 | ||
| Organism | Actinobacillus equuli subsp. equuli strain CCUG2041 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0GF68 |
| Locus tag | NYR65_RS11110 | Protein ID | WP_005621659.1 |
| Coordinates | 2360342..2360713 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | NYR65_RS11115 | Protein ID | WP_039198813.1 |
| Coordinates | 2360694..2360984 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR65_RS11095 (NYR65_11095) | 2356849..2357703 | + | 855 | WP_039198806.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| NYR65_RS11100 (NYR65_11100) | 2357747..2358316 | - | 570 | WP_039198809.1 | elongation factor P hydroxylase | - |
| NYR65_RS11105 (NYR65_11105) | 2358376..2360124 | - | 1749 | WP_039198811.1 | protein-disulfide reductase DsbD | - |
| NYR65_RS11110 (NYR65_11110) | 2360342..2360713 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYR65_RS11115 (NYR65_11115) | 2360694..2360984 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NYR65_RS11120 (NYR65_11120) | 2361052..2362014 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
| NYR65_RS11125 (NYR65_11125) | 2362087..2362584 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| NYR65_RS11130 (NYR65_11130) | 2362809..2363543 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| NYR65_RS11135 (NYR65_11135) | 2363563..2364282 | + | 720 | WP_039198822.1 | transporter substrate-binding domain-containing protein | - |
| NYR65_RS11140 (NYR65_11140) | 2364288..2364959 | + | 672 | WP_039198825.1 | arginine ABC transporter permease ArtQ | - |
| NYR65_RS11145 (NYR65_11145) | 2364959..2365642 | + | 684 | WP_039198827.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256705 WP_005621659.1 NZ_CP103811:2360342-2360713 [Actinobacillus equuli subsp. equuli]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|