Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2354333..2354975 | Replicon | chromosome |
Accession | NZ_CP103810 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain CCUG19799 |
Toxin (Protein)
Gene name | higB | Uniprot ID | K0GF68 |
Locus tag | NYR64_RS10975 | Protein ID | WP_005621659.1 |
Coordinates | 2354333..2354704 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR64_RS10980 | Protein ID | WP_039198813.1 |
Coordinates | 2354685..2354975 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR64_RS10960 (NYR64_10960) | 2350841..2351695 | + | 855 | WP_279437193.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
NYR64_RS10965 (NYR64_10965) | 2351739..2352308 | - | 570 | WP_279437970.1 | elongation factor P hydroxylase | - |
NYR64_RS10970 (NYR64_10970) | 2352367..2354115 | - | 1749 | WP_279437194.1 | protein-disulfide reductase DsbD | - |
NYR64_RS10975 (NYR64_10975) | 2354333..2354704 | + | 372 | WP_005621659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR64_RS10980 (NYR64_10980) | 2354685..2354975 | + | 291 | WP_039198813.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NYR64_RS10985 (NYR64_10985) | 2355043..2356005 | - | 963 | WP_039198815.1 | calcium/sodium antiporter | - |
NYR64_RS10990 (NYR64_10990) | 2356078..2356575 | + | 498 | WP_039198817.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR64_RS10995 (NYR64_10995) | 2356800..2357534 | + | 735 | WP_039198820.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR64_RS11000 (NYR64_11000) | 2357554..2358273 | + | 720 | WP_279437195.1 | transporter substrate-binding domain-containing protein | - |
NYR64_RS11005 (NYR64_11005) | 2358279..2358950 | + | 672 | WP_279437196.1 | arginine ABC transporter permease ArtQ | - |
NYR64_RS11010 (NYR64_11010) | 2358950..2359633 | + | 684 | WP_279437198.1 | arginine ABC transporter permease ArtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14938.10 Da Isoelectric Point: 9.5717
>T256704 WP_005621659.1 NZ_CP103810:2354333-2354704 [Actinobacillus equuli subsp. haemolyticus]
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
MYEIVFYRDRRGREPVKEFLQEFINEQQDENRERLHKISHHLTILHLHGTRAGESYIKHLEDRIWQLRPISDCLLFAGIV
RGQFVLLHHFAKSSSRLPKRELERAKSRLADLQERIKDEPHWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|