Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2108933..2109522 | Replicon | chromosome |
Accession | NZ_CP103809 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NYR62_RS09885 | Protein ID | WP_279468694.1 |
Coordinates | 2109190..2109522 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NYR62_RS09880 | Protein ID | WP_279475549.1 |
Coordinates | 2108933..2109193 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR62_RS09850 (NYR62_09850) | 2104064..2104831 | + | 768 | WP_279475539.1 | M48 family metallopeptidase | - |
NYR62_RS09855 (NYR62_09855) | 2105376..2105990 | + | 615 | WP_279457447.1 | RNA pyrophosphohydrolase | - |
NYR62_RS09860 (NYR62_09860) | 2105990..2106778 | + | 789 | WP_279475541.1 | sulfite exporter TauE/SafE family protein | - |
NYR62_RS09865 (NYR62_09865) | 2106834..2107628 | + | 795 | WP_279475544.1 | prolipoprotein diacylglyceryl transferase | - |
NYR62_RS09870 (NYR62_09870) | 2107788..2108018 | + | 231 | WP_279475546.1 | hypothetical protein | - |
NYR62_RS09875 (NYR62_09875) | 2108189..2108854 | + | 666 | WP_279475548.1 | phosphoglycolate phosphatase | - |
NYR62_RS09880 (NYR62_09880) | 2108933..2109193 | + | 261 | WP_279475549.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NYR62_RS09885 (NYR62_09885) | 2109190..2109522 | + | 333 | WP_279468694.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYR62_RS09890 (NYR62_09890) | 2109661..2110689 | + | 1029 | WP_279475550.1 | tryptophan--tRNA ligase | - |
NYR62_RS09895 (NYR62_09895) | 2110763..2111209 | - | 447 | WP_279475552.1 | macrodomain Ter protein MatP | - |
NYR62_RS09900 (NYR62_09900) | 2111294..2112931 | + | 1638 | WP_279475553.1 | AAA family ATPase | - |
NYR62_RS09905 (NYR62_09905) | 2113043..2113573 | + | 531 | WP_279475554.1 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA | - |
NYR62_RS09910 (NYR62_09910) | 2113661..2114191 | + | 531 | WP_279475555.1 | type II secretion system protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11994.91 Da Isoelectric Point: 5.8100
>T256700 WP_279468694.1 NZ_CP103809:2109190-2109522 [Actinobacillus genomosp. 1]
MKRGDVYWLDLNPTLGHEQAGCRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLQNSGLKTTGIVRCDQPRTV
DIIQRNGKFIEVLPEDLLDEVMARVSVIFE
MKRGDVYWLDLNPTLGHEQAGCRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLQNSGLKTTGIVRCDQPRTV
DIIQRNGKFIEVLPEDLLDEVMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|