Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1954730..1955358 | Replicon | chromosome |
Accession | NZ_CP103809 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYR62_RS08985 | Protein ID | WP_279475412.1 |
Coordinates | 1954960..1955358 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYR62_RS08980 | Protein ID | WP_279475411.1 |
Coordinates | 1954730..1954960 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR62_RS08975 (NYR62_08975) | 1952576..1954207 | + | 1632 | WP_279475410.1 | hypothetical protein | - |
NYR62_RS08980 (NYR62_08980) | 1954730..1954960 | + | 231 | WP_279475411.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NYR62_RS08985 (NYR62_08985) | 1954960..1955358 | + | 399 | WP_279475412.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NYR62_RS08990 (NYR62_08990) | 1955494..1955910 | - | 417 | WP_005618204.1 | DUF417 family protein | - |
NYR62_RS08995 (NYR62_08995) | 1956156..1956806 | + | 651 | WP_279475414.1 | DUF2202 domain-containing protein | - |
NYR62_RS09000 (NYR62_09000) | 1956880..1957539 | - | 660 | WP_279475415.1 | hypothetical protein | - |
NYR62_RS09005 (NYR62_09005) | 1957853..1959175 | - | 1323 | WP_279475416.1 | HslU--HslV peptidase ATPase subunit | - |
NYR62_RS09010 (NYR62_09010) | 1959230..1959751 | - | 522 | WP_279475417.1 | ATP-dependent protease subunit HslV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1947247..1957539 | 10292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15155.46 Da Isoelectric Point: 8.1004
>T256699 WP_279475412.1 NZ_CP103809:1954960-1955358 [Actinobacillus genomosp. 1]
MLAYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKHGKIIRENDIHVAAHARSEGLVLVTNNLREFERVEGLRLDNWV
MLAYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKHGKIIRENDIHVAAHARSEGLVLVTNNLREFERVEGLRLDNWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|