Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1532181..1532826 | Replicon | chromosome |
Accession | NZ_CP103809 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | toxT | Uniprot ID | - |
Locus tag | NYR62_RS06940 | Protein ID | WP_279456935.1 |
Coordinates | 1532455..1532826 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NYR62_RS06935 | Protein ID | WP_279456934.1 |
Coordinates | 1532181..1532474 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR62_RS06905 (NYR62_06905) | 1527503..1528186 | - | 684 | WP_279475039.1 | arginine ABC transporter permease ArtM | - |
NYR62_RS06910 (NYR62_06910) | 1528186..1528857 | - | 672 | WP_005598470.1 | arginine ABC transporter permease ArtQ | - |
NYR62_RS06915 (NYR62_06915) | 1528863..1529582 | - | 720 | WP_279475042.1 | transporter substrate-binding domain-containing protein | - |
NYR62_RS06920 (NYR62_06920) | 1529603..1530337 | - | 735 | WP_279456931.1 | arginine ABC transporter ATP-binding protein ArtP | - |
NYR62_RS06925 (NYR62_06925) | 1530572..1531069 | - | 498 | WP_279456932.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
NYR62_RS06930 (NYR62_06930) | 1531142..1532104 | + | 963 | WP_279468296.1 | calcium/sodium antiporter | - |
NYR62_RS06935 (NYR62_06935) | 1532181..1532474 | - | 294 | WP_279456934.1 | helix-turn-helix domain-containing protein | Antitoxin |
NYR62_RS06940 (NYR62_06940) | 1532455..1532826 | - | 372 | WP_279456935.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR62_RS06945 (NYR62_06945) | 1533028..1534779 | + | 1752 | WP_279475045.1 | protein-disulfide reductase DsbD | - |
NYR62_RS06950 (NYR62_06950) | 1534838..1535407 | + | 570 | WP_279475047.1 | elongation factor P hydroxylase | - |
NYR62_RS06955 (NYR62_06955) | 1535451..1536305 | - | 855 | WP_279475049.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15024.49 Da Isoelectric Point: 10.2796
>T256697 WP_279456935.1 NZ_CP103809:c1532826-1532455 [Actinobacillus genomosp. 1]
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKEQQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKNNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|