Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2163803..2164392 | Replicon | chromosome |
Accession | NZ_CP103808 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NYR61_RS10280 | Protein ID | WP_279468694.1 |
Coordinates | 2164060..2164392 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NYR61_RS10275 | Protein ID | WP_279468693.1 |
Coordinates | 2163803..2164063 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR61_RS10245 (NYR61_10245) | 2158932..2159699 | + | 768 | WP_279468688.1 | M48 family metallopeptidase | - |
NYR61_RS10250 (NYR61_10250) | 2160245..2160862 | + | 618 | WP_279468689.1 | RNA pyrophosphohydrolase | - |
NYR61_RS10255 (NYR61_10255) | 2160862..2161650 | + | 789 | WP_279468690.1 | sulfite exporter TauE/SafE family protein | - |
NYR61_RS10260 (NYR61_10260) | 2161706..2162500 | + | 795 | WP_279468691.1 | prolipoprotein diacylglyceryl transferase | - |
NYR61_RS10265 (NYR61_10265) | 2162659..2162889 | + | 231 | WP_005599594.1 | hypothetical protein | - |
NYR61_RS10270 (NYR61_10270) | 2163059..2163724 | + | 666 | WP_279468692.1 | phosphoglycolate phosphatase | - |
NYR61_RS10275 (NYR61_10275) | 2163803..2164063 | + | 261 | WP_279468693.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NYR61_RS10280 (NYR61_10280) | 2164060..2164392 | + | 333 | WP_279468694.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYR61_RS10285 (NYR61_10285) | 2164531..2165559 | + | 1029 | WP_279468695.1 | tryptophan--tRNA ligase | - |
NYR61_RS10290 (NYR61_10290) | 2165632..2166078 | - | 447 | WP_279468696.1 | macrodomain Ter protein MatP | - |
NYR61_RS10295 (NYR61_10295) | 2166163..2167800 | + | 1638 | WP_279468697.1 | AAA family ATPase | - |
NYR61_RS10300 (NYR61_10300) | 2167912..2168442 | + | 531 | WP_279468699.1 | bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase | - |
NYR61_RS10305 (NYR61_10305) | 2168530..2169060 | + | 531 | WP_279468700.1 | type II secretion system protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11994.91 Da Isoelectric Point: 5.8100
>T256695 WP_279468694.1 NZ_CP103808:2164060-2164392 [Actinobacillus genomosp. 1]
MKRGDVYWLDLNPTLGHEQAGCRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLQNSGLKTTGIVRCDQPRTV
DIIQRNGKFIEVLPEDLLDEVMARVSVIFE
MKRGDVYWLDLNPTLGHEQAGCRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLQNSGLKTTGIVRCDQPRTV
DIIQRNGKFIEVLPEDLLDEVMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|