Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2011032..2011660 | Replicon | chromosome |
Accession | NZ_CP103808 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NYR61_RS09385 | Protein ID | WP_279468585.1 |
Coordinates | 2011262..2011660 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NYR61_RS09380 | Protein ID | WP_279468584.1 |
Coordinates | 2011032..2011262 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR61_RS09370 (NYR61_09370) | 2008879..2010438 | + | 1560 | WP_279468583.1 | hypothetical protein | - |
NYR61_RS09375 (NYR61_09375) | 2010784..2010957 | - | 174 | Protein_1804 | addiction module antidote protein, HigA family | - |
NYR61_RS09380 (NYR61_09380) | 2011032..2011262 | + | 231 | WP_279468584.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NYR61_RS09385 (NYR61_09385) | 2011262..2011660 | + | 399 | WP_279468585.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NYR61_RS09390 (NYR61_09390) | 2011795..2012211 | - | 417 | WP_005609158.1 | DUF417 family protein | - |
NYR61_RS09395 (NYR61_09395) | 2012458..2013090 | + | 633 | WP_279468586.1 | DUF2202 domain-containing protein | - |
NYR61_RS09400 (NYR61_09400) | 2013290..2014069 | - | 780 | WP_279468587.1 | hypothetical protein | - |
NYR61_RS09405 (NYR61_09405) | 2014142..2015464 | - | 1323 | WP_005620148.1 | HslU--HslV peptidase ATPase subunit | - |
NYR61_RS09410 (NYR61_09410) | 2015519..2016040 | - | 522 | WP_005618211.1 | ATP-dependent protease subunit HslV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1998661..2014069 | 15408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15086.35 Da Isoelectric Point: 7.0614
>T256694 WP_279468585.1 NZ_CP103808:2011262-2011660 [Actinobacillus genomosp. 1]
MLTYMLDTNIAIYVIKRRPLEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPEQNMAVIEDFLSRLTILDYTHKEATHF
GNIKAHLSKHGKIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
MLTYMLDTNIAIYVIKRRPLEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPEQNMAVIEDFLSRLTILDYTHKEATHF
GNIKAHLSKHGKIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|